SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008840 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008840
Domain Number 1 Region: 518-634
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.29e-29
Family UBX domain 0.0000172
Further Details:      
 
Domain Number 2 Region: 335-487
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000134
Family Glutathione peroxidase-like 0.076
Further Details:      
 
Domain Number 3 Region: 90-178
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000151
Family Ubiquitin-related 0.022
Further Details:      
 
Domain Number 4 Region: 191-259
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000669
Family Ubiquitin-related 0.043
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008840
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily UBA-like 0.00561
Family TAP-C domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008840   Gene: ENSTTRG00000009322   Transcript: ENSTTRT00000009321
Sequence length 636
Comment pep:novel genescaffold:turTru1:GeneScaffold_3131:44691:547981:-1 gene:ENSTTRG00000009322 transcript:ENSTTRT00000009321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILRSDYGGEP
ISGPAFDPASHPAPAPAPAPSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLED
SCTVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPS
SSSHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWE
GWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQSTDVHMVSDSDGDDFED
ASEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLE
ATFQEAFYVKARDRKLLAVYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKD
ANRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMM
RLMAAMEIFTAQQQEDIKDERDRNEKASRKLREAHEREMAEQFRLEQIRKEQEEEREAIR
LSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEFK
LLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Download sequence
Identical sequences ENSTTRP00000008840 ENSTTRP00000008840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]