SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008853 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008853
Domain Number 1 Region: 264-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-20
Family Complement control module/SCR domain 0.00000613
Further Details:      
 
Domain Number 2 Region: 83-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.21e-17
Family Complement control module/SCR domain 0.0000497
Further Details:      
 
Domain Number 3 Region: 140-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000431
Family Complement control module/SCR domain 0.0000694
Further Details:      
 
Domain Number 4 Region: 205-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.0000385
Further Details:      
 
Domain Number 5 Region: 22-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000958
Family Complement control module/SCR domain 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008853   Gene: ENSTTRG00000009335   Transcript: ENSTTRT00000009335
Sequence length 345
Comment pep:novel genescaffold:turTru1:GeneScaffold_3549:884904:897011:-1 gene:ENSTTRG00000009335 transcript:ENSTTRT00000009335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPVLLLFSSFLCHVAIAGRICPKPDDLPFARFVPLKTSYAPGEEIVFSCQPGYVSRGG
IRRFTCPLTGFWPINTLRCTPRVCPFAGILENGTVRYTTFEYPNTINFSCNTGFYLKGAN
SVQCTKEGEWSQKLPVCAPITCPPPPIPKFAKLSVYQPLSGNNSLYGGKAVFECLPQHAM
FGNDTVTCTEHGNWTELPECKEVKCPFPSRPDNGFVNYPAKQVLYYKDKATYGCHDTYAL
DGPEEVECGKFGKWSAQPSCKASCKLSVKKATVIYEGERVNIQDKFKNGMLHGQKISFFC
KNKEKKCSYTEDAQCIDGVIQIPKCFKEHSSFAFWKTEASDVKPC
Download sequence
Identical sequences ENSTTRP00000008853 ENSTTRP00000008853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]