SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008973 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008973
Domain Number 1 Region: 358-549
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.29e-50
Family cAMP-binding domain 0.0000000268
Further Details:      
 
Domain Number 2 Region: 91-361
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-36
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008973   Gene: ENSTTRG00000009465   Transcript: ENSTTRT00000009465
Sequence length 780
Comment pep:novel genescaffold:turTru1:GeneScaffold_2301:88495:97403:1 gene:ENSTTRG00000009465 transcript:ENSTTRT00000009465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEQRPTTRASDGATPGLERAPPAAPASTTTASDPIPGSRPGTGPEPKRRQLGTLLQPT
VNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGIT
FFKEENSPPWIVFNVLSDTFFLMDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVD
LISSIPVDYIFLVVELEPRLDTEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEE
IFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNYSWGR
QYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSS
RRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIIN
FTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVL
ARGARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAF
ETVAMDRLRRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGLAPGTGARL
SGKPVLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPVTLLARSARRSAGAGSPA
SPLVPVRAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSA
SQPSLPQRAAGDGSPGCKGSGGERLPPSGLLAKPPGTAQPPRPSVPEPATPRGPQLSSNM
Download sequence
Identical sequences ENSTTRP00000008973 ENSTTRP00000008973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]