SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009010 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009010
Domain Number 1 Region: 15-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.21e-24
Family Ubiquitin-related 0.0000151
Further Details:      
 
Domain Number 2 Region: 613-655
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000689
Family UBA domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009010   Gene: ENSTTRG00000009511   Transcript: ENSTTRT00000009509
Sequence length 656
Comment pep:novel scaffold:turTru1:scaffold_93543:130760:132730:-1 gene:ENSTTRG00000009511 transcript:ENSTTRT00000009509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSGEALPQGSPVLVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQ
LILIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTVGTECPAASVPIPAPSLGSLPQP
SSIYPADRLPTFSLGVLTGLNGLGLTSGSFPDPPSSLMWQDMSVPEFVAQIIDDAFIQGL
LSNTGLVRQLVLDNPHMQQLIQHNPEIGHILNNPEIMRQTMEFLCKPAMMQEMMRSQDRA
LRNLESIPGGYNVLRTMYTDIMHPMLNAVQEQFGGNPFATTTTANATTSSCQPSRMENCD
PLPNPWASTFAGSAGRRGRRPGDQDVSELRNGVCNILGNMRLYDYLQQLHERPLSLRTYL
QGIASTLSPSQEPPSPPGSQVPPTSPSSQELESGRPLPRESVAIKGKPSCPAFLRYPTES
SARKAGSRDGAGNGSTAHSTNMPDLVSRLECAADKAPFVPSPPSPTAVTAGTPEHVWLPP
PAYPRPLRPARMNEAPQLQDEMRWQLPLLLHLQAAMANPRAMHALLQIEQGLQILATEAP
RLLLLFMPCLAGLGSTAGSTEPREGALMPADPPLDPGPEVPSAQGSVELGLHSMPFLQML
QALAGANPLQLQPETHFRVQLEQLRAMGFLNLEANLQALIATGGDVDAAVKKLRQL
Download sequence
Identical sequences ENSTTRP00000009010 ENSTTRP00000009010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]