SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009040 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009040
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily E set domains 5.6e-78
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000417
Further Details:      
 
Domain Number 2 Region: 68-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-23
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009040   Gene: ENSTTRG00000009542   Transcript: ENSTTRT00000009540
Sequence length 419
Comment pep:novel scaffold:turTru1:scaffold_91459:5129:9807:-1 gene:ENSTTRG00000009542 transcript:ENSTTRT00000009540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDSRNAMNQDMEIGVTPRDPKKVPKQARDYIPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
IGDREWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSSNAVISLRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLNQEEFE
IVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQFLPSPPLPAGCAGAELDAEAERDGEEEPEGPSGSRETRGSV
Download sequence
Identical sequences ENSTTRP00000009040 ENSTTRP00000009040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]