SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009044 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009044
Domain Number 1 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 23-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-25
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 3 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 651-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 10 Region: 693-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009044   Gene: ENSTTRG00000009547   Transcript: ENSTTRT00000009544
Sequence length 752
Comment pep:novel scaffold:turTru1:scaffold_102252:78686:95413:-1 gene:ENSTTRG00000009547 transcript:ENSTTRT00000009544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLSSPESALLQGGHTSLPSASFQESVTFKDVIVDFTQEEWKQLDPVQRDLFRDVTLEN
YTHLVSIGLQVSKPDVISQLEQGTEPWIVEPSIPVGALGDWETRPENSISVSELDISEEE
PSPEAIVEKHKRDDPWGSNVLETGESEGSPERQQANEQALPREIKITDKTVPTLKRDHVN
NDFEKSINVSSDLLTQKEVSPEETSTKTSVKQNLKPVKKEKSCKCNECGKAFSYCSALIR
HQRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRI
HTGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGE
KPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYE
CNECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNEC
GKAFSYCSSLTQHRRIHTREKPFECNECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAF
IRSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPYKCNECGRAFNQNI
HLTQHKRIHTGAKPYECAKCGKAFRHCSSLAQHQKTHTEEKPYQCNKCEKAFSQSSHLAQ
HQRIHTGEKPYKCNECDKSFSRSTHLTEHQNTHTGEKPYNCNECRKTFSQSTYLIQHQRI
HSGEKPFGCNDCGKAFRYRSALNKHQRLHPGI
Download sequence
Identical sequences ENSTTRP00000009044 XP_019800413.1.83887 XP_019800414.1.83887 XP_019800415.1.83887 XP_019800416.1.83887 XP_019800418.1.83887 ENSTTRP00000009044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]