SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009258 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009258
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-28
Family GABARAP-like 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009258   Gene: ENSTTRG00000009768   Transcript: ENSTTRT00000009765
Sequence length 80
Comment pep:novel genescaffold:turTru1:GeneScaffold_2224:128207:129031:-1 gene:ENSTTRG00000009768 transcript:ENSTTRT00000009765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQE
HHEEDFFLYIAYSDESVYGL
Download sequence
Identical sequences ENSTTRP00000009258 ENSTTRP00000009258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]