SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009306 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009306
Domain Number 1 Region: 209-458
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.33e-58
Family Voltage-gated potassium channels 0.00047
Further Details:      
 
Domain Number 2 Region: 120-180
Classification Level Classification E-value
Superfamily POZ domain 0.000000994
Family Tetramerization domain of potassium channels 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009306   Gene: ENSTTRG00000009817   Transcript: ENSTTRT00000009814
Sequence length 508
Comment pep:novel scaffold:turTru1:scaffold_102339:25342:27469:1 gene:ENSTTRG00000009817 transcript:ENSTTRT00000009814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDACGWKEMEVALVNFDNSDEIQEEPAYATDFDLTTPKGQTGSXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRMQ
FFDSMRNEYFDRNRPSFDVIYYYQSGGKIRRPASVPIDVFADEIFYELGSEAMDQFREDE
GFIKDPETLFPTNDIHRQFWLLFEYPESSSAARGVAMVSVLVVVISITVFCLETLPEFQE
DRELKVVRDSSLNMSKTVLSHTMFTDPFFVVESTCIMWFTFELVLRFVVCPSKTDFFRNI
INIIDIISIIPYFATLITELVQETEPSTQQNMSLAILRVIRLVRVFRIFKLSRHSKGLQI
LGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVG
YGDMCPTTPGGKIVGTLCAIAGVLTVALPVPVIVSNFNYFYHRETENEEKQNIPGKIDKL
LNSVGSRMGSTDSLSKTNNGCSSEKSRK
Download sequence
Identical sequences ENSTTRP00000009306 ENSTTRP00000009306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]