SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009458 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009458
Domain Number 1 Region: 304-589
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-71
Family Protein kinases, catalytic subunit 0.00000000788
Further Details:      
 
Domain Number 2 Region: 20-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-22
Family Ras-binding domain, RBD 0.0000213
Further Details:      
 
Domain Number 3 Region: 92-144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009458   Gene: ENSTTRG00000009969   Transcript: ENSTTRT00000009972
Sequence length 609
Comment pep:novel genescaffold:turTru1:GeneScaffold_310:79297:87695:1 gene:ENSTTRG00000009969 transcript:ENSTTRT00000009972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQPSRFYHSVQDLSGGSRQHEAPSNRPLN
EPLTPQGPSSCTQHRDPKHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSGLIQLPAQ
SFNTDAAGNRGGGDGTPRGSPSPASMSSGRKSPHSKSPSEQRERKSLADDKKKVKNLGYR
DSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQV
LRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEV
IRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSN
CPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPAC
LLSAARLVP
Download sequence
Identical sequences ENSTTRP00000009458 ENSTTRP00000009458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]