SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009573 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009573
Domain Number 1 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 386-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-17
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 289-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 210-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000411
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 320-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000725
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 428-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000863
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 68-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000231
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000009573
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00418
Family KRAB domain (Kruppel-associated box) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009573   Gene: ENSTTRG00000010093   Transcript: ENSTTRT00000010092
Sequence length 505
Comment pep:novel scaffold:turTru1:scaffold_84355:7648:11417:1 gene:ENSTTRG00000010093 transcript:ENSTTRT00000010092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYKNLTTAGYQSLKPTLISWWEQEDDLRTAERKGVLQWEMQLKTKDSAIQQDNLGRE
TSVGMETARMHNGRKLCNCEQYRKDFNEHLSLRTGRRTQNGGNTYEHNEYGKSFLTLQKK
TSMVVKHFVFNHCGKAIILTPNIVDRKTCMGEKAFECSDGEEPCVNQPSLQAQVVTQNGE
KHCEQKEHGRASVHSTRHGIPVRNHTTKNSYECKERGKVYKYHISIKIHMGTHNGEKPYK
CKECGKAFIIAYELKRHIKTHTGEKPFICKECGKAFIRAYHLRSHIKSHTAERPYKCREC
GKAFLTSYRLKEHIKSHSEERPFPCEKCGKFFKSSSYLKIHNIHTGTKPYKCTECGKAFI
RPFALTEHMETHARKFLCEDCGKFVRSQFRDHRKSHIGDKPFLCDQCGKSFKHSLYLHRH
KTIHSGIKPYKCDKCGRAFLGNQTSKHVQTHGGEKETGCKQCEKSFSYSNSQETHPLAKS
YKRICEKAFSSLCSFLVRYHFVLMS
Download sequence
Identical sequences ENSTTRP00000009573 ENSTTRP00000009573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]