SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009762 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009762
Domain Number 1 Region: 155-267
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-21
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 4-32,84-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000772
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009762   Gene: ENSTTRG00000010290   Transcript: ENSTTRT00000010288
Sequence length 394
Comment pep:novel genescaffold:turTru1:GeneScaffold_254:379160:385301:1 gene:ENSTTRG00000010290 transcript:ENSTTRT00000010288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSTTLLALLAVVLLYLVSGALVFQALEQPHEQQAQRELGEVREKFLRAHPCVSDQDLGL
FIKEVADALGGGANPDTNSTRNSNHSAWDLGSAFFFSGTIITTIXXXXXXXXTDAARLFC
IFYAMKRIPVFGILTEVGDRKELYIRRSNDHIEAIFMKWQVPPELVRILSAVLFLLIGCL
LFVLTPTFVFCYVEGWSKLEAIYFVVVTLTTVGFGDYVAGASPNQNSAAYQPLVWFWILL
GLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRVGPTAPPPPEKE
RPPLLPPPCPAQPASRPLSPAAPEKTEPPSPPTASALDYPSENLAFIDESSDTQSERGCA
LPRAPRGSRRPLNTPRKPARPRGPGRPRDKGVPA
Download sequence
Identical sequences ENSTTRP00000009762 ENSTTRP00000009762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]