SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009765 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009765
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.93e-17
Family Cytochrome b5 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000009765
Domain Number - Region: 138-199
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0202
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009765   Gene: ENSTTRG00000010293   Transcript: ENSTTRT00000010291
Sequence length 228
Comment pep:novel genescaffold:turTru1:GeneScaffold_2225:267581:269101:1 gene:ENSTTRG00000010293 transcript:ENSTTRT00000010291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRGLVAGPDFEYFQRRYFTPAEVAQHNQPEDLWVSYLGNVYDLTPLAQEYKGDLLLKP
IVEVAGQDISHWFDPDTRDIRKHIDPLTGSLRYRTPWGRFLHVPPQLPRSDWANDFGKPW
WQGSRYEVGRLSAKTRNIRIINTLTSQEHTLEVGALESMWEILHRYLLYNAHAASYTWKY
EGKNLNMDYTLEENGIRDEEEEFDYLNMDSTLYTPAVLLYFSDDLTEL
Download sequence
Identical sequences ENSTTRP00000009765 XP_004266936.1.21590 ENSTTRP00000009765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]