SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009947 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009947
Domain Number 1 Region: 143-229
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.71e-21
Family Ubiquitin-related 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009947   Gene: ENSTTRG00000010490   Transcript: ENSTTRT00000010487
Sequence length 296
Comment pep:novel genescaffold:turTru1:GeneScaffold_447:131207:132349:1 gene:ENSTTRG00000010490 transcript:ENSTTRT00000010487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDVTLIEGVGNEVTVVAGVAVLILALVLAWLSTYVADSGSSQLLGTIVSAGDTSVLH
LGHVDHLVAGQVTPEPTELPHPSEGNDEKAEEAGEGGGDSTGEPGAGGGIEPSLEHLLDI
QGLPKRQAGPGSSGPEVPQRSEDSACLINVRLKFLNDTEELAVARPEDTVGALKSKYFPG
QESQMKLIYQGRLLQDPGRTLRSLNITDNCVIHCHHSPLGSAVPGPSASLAPSSATEPPS
LGVSVGSLMVPVFVVLLGVVWYFRINYRQFFTAPATVSLVGVTVFFSFLVFGMYGR
Download sequence
Identical sequences ENSTTRP00000009947 XP_019795035.1.83887 ENSTTRP00000009947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]