SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009971 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009971
Domain Number 1 Region: 14-64,102-152
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000132
Family Calponin-homology domain, CH-domain 0.0045
Further Details:      
 
Domain Number 2 Region: 593-649
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000061
Family DIX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009971   Gene: ENSTTRG00000010511   Transcript: ENSTTRT00000010511
Sequence length 650
Comment pep:novel genescaffold:turTru1:GeneScaffold_3620:508741:568138:1 gene:ENSTTRG00000010511 transcript:ENSTTRT00000010511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPTVKPVQDLRQDLRDGVILAYLI
EIVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEGNLKSIMRLVL
ALAAHFKPGSSRTVNQGQDARAPLQSHQPHCATAVAQGAAAALADVCHDMSRSGRDVFRY
RQRNSSVDEEIGNPCWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSDSIITQLEE
KADFVIIPSEGIENKTEETDSPLSRDWRPGPRPYLETSWEEQLLEQQEHLEKEMEEAKKM
ISGLQXXXXXXSLPEDEQERLALCESGVNPEEQLIIIQSRLDQSMEENQDLKKELLKYKQ
EGRNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLLGE
YKKELWQKDRLKQYQAKLEEALRKLSEASYQQVDLEHKDVLLAHCMKREAEEVTHCSSHN
PQSNGFLLPVAGKGAASVTHRGSSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSL
MERLHAMETQRKQDRRVRGKSPRTQAGSEYRESWPPNSKLSHSQSSPTVSSACTKVLYFT
DRSLTPFMVNIPKRLGEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEE
Download sequence
Identical sequences ENSTTRP00000009971 ENSTTRP00000009971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]