SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009994 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009994
Domain Number 1 Region: 170-276,333-551
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.26e-79
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000787
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000009994
Domain Number - Region: 689-751
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000434
Family Ubiquitin-related 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009994   Gene: ENSTTRG00000010536   Transcript: ENSTTRT00000010538
Sequence length 1362
Comment pep:novel genescaffold:turTru1:GeneScaffold_2632:46145:125723:1 gene:ENSTTRG00000010536 transcript:ENSTTRT00000010538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVFWRCRQNIFDEMKKKFLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGE
QPQILLEDSSAGDDSVHDKFIGPLPREGSVGSTSDYVSQSYSYSSILNKSETGYVGLVNQ
AMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIET
TDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEALHAFIQPEILDGPNQYFCERCKKKCDA
RKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTES
CTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLESNSGTEKIPKPGLEKNSLIYELFSVM
VHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASS
TNAYMLIYRLKDPARNAKFLEVDEYPEHIKNLVQRERELEEQEKRQREIERNTCKIKLFC
LHPVKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPMDCCRLVKYDEFHDYLERSYE
GEEDTPMGLLLGGVKSTYMFDLLLETRRPDQVFQSYKPGEVMVKVHVVDLKAESVAAPIT
VRAYLNQTVTEFKQLISKAIYLPAETMRIVLERCYNDLRLLTVPSKTLKAEGFFRSNKVF
VESSETLDYQMAFTDSHLWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVD
DDCERVKGPAGGLKSVEAILEESTEKLKSLSLQQQQEGDNGDSSKSTETSDFENIESPLN
ERDSSASVDNRELEQHIQTSDPENFQSEERSDSDVNNDRSTSSXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFE
SVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVR
QSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVL
DGAEKMKSMSQLAVLSRRWRPSEMKLDPFQEVVLESSSVDELREKLCEISGIPLEDIEFA
KGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRN
ELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Download sequence
Identical sequences ENSTTRP00000009994 ENSTTRP00000009994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]