SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010076 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010076
Domain Number 1 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 439-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.33e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 534-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 7 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 282-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000214
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 399-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000108
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010076
Domain Number - Region: 136-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000987
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010076   Gene: ENSTTRG00000010631   Transcript: ENSTTRT00000010628
Sequence length 595
Comment pep:novel genescaffold:turTru1:GeneScaffold_3329:450552:473709:-1 gene:ENSTTRG00000010631 transcript:ENSTTRT00000010628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVTFEDVAVLFTRDEWRKLAPSQRNLYQDVMLENYSNLVSLGLPFSKPEVISLLQQGED
PWKVVKESPGGSSLGRKNSYKTTKSTQTQGSSFQEMIMKRSKRNGPWDFKSEKPCKYEDR
LEKKQKKNQSVQIVSVTHKKIFTVERKHKNTEFGQNFSLKSVLVRQQMVPREKTPPKCEI
QGNSFKQNSNLLNQQKINTAGKRYKCSMCEKTFINTSSLRKHEKNHSGEKLFKCKDCSKA
FNQSSALIQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYRCKECGKSFSRR
SGLFIHQKIHAGENPYKYNPGRKASSCNTSLPGCQRMNSRKKSYLCNECGNTFKSSSSLR
YHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFTSISRLNRHRI
IHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTG
ERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQHRRIHTGEKPF
KCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKIHIEENP
Download sequence
Identical sequences ENSTTRP00000010076 ENSTTRP00000010076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]