SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010108 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010108
Domain Number 1 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 6 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 3-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 170-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.95e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010108   Gene: ENSTTRG00000010662   Transcript: ENSTTRT00000010661
Sequence length 642
Comment pep:novel genescaffold:turTru1:GeneScaffold_3220:245934:255983:-1 gene:ENSTTRG00000010662 transcript:ENSTTRT00000010661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKSQISFEDVAVDFTLEEWQLLNPTQKTLYRDVMLENYSNLVFLEVWLDNNLKMWHQDN
QDKLKSMERGHEYDVFGKMFHSGINFDHLGMRSHKCGTGEKSLKHPFDFLIPKSNCERKK
LDELNKKLLFCIKPDKTCGGIKYSDCSKCRKVSSKEPGLITNQIAHTGVCLCMECGKVFN
KKSQLIIHQRTHTGEKPYGCHDCGKAFSQKSLLTIHQRTHSGEKPYGCGECQKAFSRKSL
LVLHQRTHTGEKPYGCRDCGKSFSRKSQLQRHQRTHTVEKPYGCNDCGKAFSQKIRLITH
QRTHTGEKPYKCSDCGKAFFWKSQLITHQRVHTGKKPYACSECKKAFSRNSLLIRHQRIH
TGEKPYECSECGEAFIRKPQLVKHQMTHTGEKNYQCRNCEEAFFKKSELIRHQKAHLGEK
PYGCVECGKTFFGKSQLLTHQRTHTGEKPYECGACGKAFTQKSSLVSHQRTHTGEKPYEC
SECGKAFSEKSSLIHHQRTHTGEKPFECSECRKAFAWKPQLLRHQRIHTGEKPYECSECG
KAFVQKVQLIKHQRNHTGEKTYGCSDCTKAFFEKAQLIIHQRIHTGERPYKCGECGKSFT
RKSHLMRHQRIHTGDKCYRCSECGTAFHRKAQLLIHQRSHML
Download sequence
Identical sequences ENSTTRP00000010108 ENSTTRP00000010108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]