SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010175 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010175
Domain Number 1 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 3-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-16
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 222-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000195
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 417-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000261
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010175
Domain Number - Region: 155-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00128
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010175   Gene: ENSTTRG00000010738   Transcript: ENSTTRT00000010731
Sequence length 457
Comment pep:novel genescaffold:turTru1:GeneScaffold_3348:4:14392:-1 gene:ENSTTRG00000010738 transcript:ENSTTRT00000010731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHGLVMFKDVAIDVSQEEWECLNPAQRNLYKDVMLENYSNLVSLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLVSKCEAKKLSPKRNIYETESSQWAIMGPFKSHSPEKSIFRD
IWACKSQFERQQGKQKGYFRQFIINHERMPIFSQHILFTQEFYNRQKIFECKECRKNFSY
NLFFSPHKTHSKEKLSEGKVCAETVDTSYLTKQQRIQNSNKCNECKECWKSFIHCSQLKQ
HLRIHKGEKHYECKECGKAFYYGSELILHQRIHTGEKPNECKECGKAFMQLSQFTQHQRL
HTGEKPYEYKQCGKAFICGFQFTEHLHLHTGEKPFEYKECGKTFRHQSSPTISQRLHSHE
KPYECKECGKTFNYGSELILHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYE
CKQCGKAFIRGFQLTEHLRLHTGEKPYECKECKDFRH
Download sequence
Identical sequences ENSTTRP00000010175 ENSTTRP00000010175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]