SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010405 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010405
Domain Number 1 Region: 105-180
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000475
Family Ras-binding domain, RBD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010405   Gene: ENSTTRG00000010979   Transcript: ENSTTRT00000010976
Sequence length 234
Comment pep:novel genescaffold:turTru1:GeneScaffold_2011:49168:112266:1 gene:ENSTTRG00000010979 transcript:ENSTTRT00000010976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGYSSLEEDAEDFFFTARTSFFRRAPQGKPRAGQQDVEKDKETNYLSKEEIKEKVHKY
NLAVTDKLKMTLNSNGIYTGFIKVQMELCKPSQTSGKLAPSSNGCMNTLHISSTNTVGEV
IEALLKKFLVTESPTKFALYKRCHREDQVYACKLSDREHPLFLRLVAGPRTDTLSFVLRE
HEFGEWEAFSLPELQNFLRILDKEEDEQLQNLKERYAAYRHKLEEALSEAWKPG
Download sequence
Identical sequences ENSTTRP00000010405 ENSTTRP00000010405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]