SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010557 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010557
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-28
Family Ras-binding domain, RBD 0.0000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010557   Gene: ENSTTRG00000011135   Transcript: ENSTTRT00000011134
Sequence length 371
Comment pep:novel scaffold:turTru1:scaffold_103543:48749:50374:1 gene:ENSTTRG00000011135 transcript:ENSTTRT00000011134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQL
LPQECPVGAQATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCPIRASLPPKPRPAP
DREPCKALAFSLGFPGLAPDPVPPEPVGPVAPKPGCCADLQGLERRVRRNAAELGQEAFW
EQELRREQAREHEGQARLQALSAATAEHAARLQALDAQTRALEAELLMAAEAPGPPSPTA
VAELRQDAAQERQEVEVQGSLLVGRALEAAEHAQAQAQELEELNRELRQCNLQQFIRQTG
AALSPSPRPDGAPPGTQDLLPPSREEPLLGPPESSPGVQPEPRDHPHEAELLEVAALAPD
WRPVPAQPWAL
Download sequence
Identical sequences ENSTTRP00000010557 ENSTTRP00000010557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]