SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010704 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010704
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 54-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-24
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 4 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-16
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010704   Gene: ENSTTRG00000011290   Transcript: ENSTTRT00000011290
Sequence length 570
Comment pep:novel genescaffold:turTru1:GeneScaffold_75:19430:28785:-1 gene:ENSTTRG00000011290 transcript:ENSTTRT00000011290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRYGGGSAPGAARGATTGATGPEEAAALPSQDSALPERNQEEDPSTHEILTVMSLGSDL
FRDVAVVFSQEEWEQLAPAQRDLYRDVMLEIYSNLVSLGFAISKPDVISFLEQGREPWMV
EKVATGGQCPVLESRYDTKVLSPKQHSYEVQSPRWQIMESLTSYGFECSSFQDDWECRSQ
FDRQEGNPDGHLSQMIIDNEEMSTFDQQASLTFYQKIHIGEKPYGYNECRKDFWQEDFLI
NHQGIHTNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGSNFIQHQR
VHTGEKPYECKDCAKAFSRSSQLIEHQRIHTGEKPYQCKECGKAFNRISHLKVHYRIHTG
EKPYACKECGKTFSHRSQLIQHHTIHTGKKLYECKECGKAFNQGSTLIRHQRIHTGEKPY
ECKACGKAFRVNSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHLTVHYRIHTGEKPYECKE
CGKAFSHCSQLIQHQVIHTEEKPYEYKECGRTLNHDSTTIQHQRMHNRETQVNLINVEKP
SISTYPLLIIREFMLASNHMNGNNGKSPLA
Download sequence
Identical sequences ENSTTRP00000010704 ENSTTRP00000010704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]