SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010929 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010929
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 2 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 191-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 131-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000179
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010929   Gene: ENSTTRG00000011523   Transcript: ENSTTRT00000011524
Sequence length 297
Comment pep:novel scaffold:turTru1:scaffold_91697:5939:9729:1 gene:ENSTTRG00000011523 transcript:ENSTTRT00000011524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLESVTFEDVAINFTQEEWALLDTSQKTLFRNVMLENITHLVSVGYQISKSDVISQLE
QGKELWSEATGCLQGQSPDGESPLRLQEMIFTQSVYRKHIFATMPMQVSHTQRDPVGWTD
LSDEFTPRSSPKHLSIHLRRKRNVSKQCGNSLSQGSFLDGQGHIHTRGKSCECPFCGKAF
SNSSLRRKMIHTGEKPYKCHVCGKVFSQSSYKEHEKIHTGEKPYKCHLCEKTFNQISYLR
KHKKIHSREKHYACHKCGKAFSQSSGLSQHKRIHTGEKPHICLLCGKAFSLLSDLRR
Download sequence
Identical sequences ENSTTRP00000010929 ENSTTRP00000010929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]