SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010959 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010959
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-28
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 2 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 488-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 386-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000842
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 7 Region: 431-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000398
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 193-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000377
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010959   Gene: ENSTTRG00000011556   Transcript: ENSTTRT00000011556
Sequence length 549
Comment pep:novel genescaffold:turTru1:GeneScaffold_590:244807:262512:1 gene:ENSTTRG00000011556 transcript:ENSTTRT00000011556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRPPTARPQESVTFKDVAVNFTQEEWHHMDPAQRRLYRDVMLENYSHLVSLGYQVSKP
EVIFKLEQGEEPWIAEGEIQRPFCPDWRTRPEAKSSNLQQSISEVSLSTDDPSCTTLEDT
WDVNGQLERHKENWKRHLGPDASTQKKIITPEEACEQNKFVENSRLNTDLVTQLNIPPRS
NECDTLGSNLGHNSDLLSQNNILAKKKPYKCNKCRKAFIHRSSLTKHEKTHKGDGTFPNG
TDQGIYPGKKHHECTDCGKTFLWKTQLTEHQRIHTGEKPFECNVCGKAFRHSSSLGQHEN
AHTGEKPYQCSLCGKAFQRSSSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSG
EKPFQCKECGKAFSRCSSLVQHERTHTGEKPFECSICGRAFGQSPSLYKHMRIHKRGKPY
QSSNYSIDFKSSSLTQDENTLTEVKSYHCNDCGEDFSHITDFSDHQRIHTRENPYDCEQA
FSQQSISHPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQH
ERTHTGEKP
Download sequence
Identical sequences ENSTTRP00000010959 ENSTTRP00000010959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]