SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010960 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010960
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.52e-39
Family Forkhead DNA-binding domain 0.0000348
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010960
Domain Number - Region: 149-202
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00105
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010960   Gene: ENSTTRG00000011568   Transcript: ENSTTRT00000011557
Sequence length 421
Comment pep:novel genescaffold:turTru1:GeneScaffold_3477:40518:41783:1 gene:ENSTTRG00000011568 transcript:ENSTTRT00000011557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNS
LRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHTHLH
AGSAKGAPGAGPGGHLHPHHHHHAAAHHHHHHHPPQPPPPQPPPPHMVHYFHQQPPPAPQ
PPPHLASQPPQQPPQPPQPSHPGKMQEAAAVAAAAAEAAAAAIGSVVRLSQFKPYGMGSD
ADAAATAADASTSSFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVS
SVWPHVGVMDSVAAATAAAAAAGVPMGPEYGAFGVPVKALCHSASQSLPAVPVPIKPTPA
LPPVAALPAALAVPAAAQQPPAPSTVCPAAAASPAVSLMEPTPPSAAESKGGSLHSVLVH
S
Download sequence
Identical sequences ENSTTRP00000010960 ENSTTRP00000010960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]