SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010966 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010966
Domain Number 1 Region: 26-86
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-25
Family KRAB domain (Kruppel-associated box) 0.00085
Further Details:      
 
Domain Number 2 Region: 371-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 412-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 177-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 125-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000124
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010966   Gene: ENSTTRG00000011572   Transcript: ENSTTRT00000011563
Sequence length 476
Comment pep:novel scaffold:turTru1:scaffold_114843:6179:22340:-1 gene:ENSTTRG00000011572 transcript:ENSTTRT00000011563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRQDKVSYDFCSDFIVSILQQQKMNKFRGPVTFKDVTVEFTQEEWQLLDAAQRTLYREVM
QENYRHLISVGYCVNKPNAVFKLKQGKEPWILEVEFPRQKYPEDLWNTHDQGARYQESQA
KNSRNGELTKHQKTHTNEKSYKCNECGKSFCQKSVLIIHEHTHSKDKPSECGKSVSRNGD
LTRQQKAPTREKTYECKECKKTFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKLHLMEH
QKTHTGEKLYECTECGKFFYVNAYLMVHQKTHTGEKPYECKECRKSFSXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PFECNKCGKNFYYKSDLTKHQRKHTGEKPYECNECGKSFSVNSVLRLHQRTHTGEKPYEC
KECGKSFSQKSHFVIHQRKHTGEKPYECQECKETFFQKSKLTAHQKTHTKGKAYKE
Download sequence
Identical sequences ENSTTRP00000010966 ENSTTRP00000010966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]