SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011033 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011033
Domain Number 1 Region: 4441-4567
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 9.81e-23
Family HEPN domain 0.0051
Further Details:      
 
Domain Number 2 Region: 1453-1640
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.07e-17
Family Heat shock protein 90, HSP90, N-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 2522-2705
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.14e-17
Family Heat shock protein 90, HSP90, N-terminal domain 0.054
Further Details:      
 
Domain Number 4 Region: 143-289
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000256
Family Heat shock protein 90, HSP90, N-terminal domain 0.019
Further Details:      
 
Domain Number 5 Region: 4294-4361
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000275
Family Chaperone J-domain 0.000024
Further Details:      
 
Domain Number 6 Region: 7-73
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000023
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011033   Gene: ENSTTRG00000011635   Transcript: ENSTTRT00000011634
Sequence length 4571
Comment pep:novel scaffold:turTru1:scaffold_103328:90603:149587:1 gene:ENSTTRG00000011635 transcript:ENSTTRT00000011634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKDTRWLRVTVLPGCVGCRTMAVPAIWTVRDVKRRIAAETGFPASEQRLWLGGRQLSD
WIRIGDLTSQNCHLFVNLQSKGLKGGGRFGQTTPPLVDFLKDILRRYPEGGQILKXXXXX
XXXXXXXXXXXXXXXXXXXXXXLWSKDMAQYQGPALYVYNNAVFTPEDWHGIQEIARSRK
KDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQTLFGPHESGQCWNLKEDSREI
SELSDQFAPFIGIFGSTKETFINGSFPGTFFRFPLRLQPSQLSSNLYNKQKVLELFESFR
ADADTVLLFLKSVQDISLHVREADGTEKLVFRVTASESAALTQERPDSIKILGAAISNYC
EKIPSSSITCVTYPINIVLEDESARGPQKTSWLVCNSVGGRGISSRLDALADELKFVPVI
GIAMLLSSGDEQEGGAASEFSGKAFCFLPLPPGEESKTGLPAHISGFFGLTDNRRSIKWR
ELDQWRDPAALWNEFLVLNIVPRAYATLILDSIERLQAGRSPDLPLSVDVIYKLWPDVKR
ATAHWQPVLEPLFHELFQHAVLYSLSGHWVPLEQACFSELDESLECTRSVLSYLQSSGKQ
VVRVPAHVAAAVQLAVSSVRPVRKVTPAWTRQVLRKAAHLGGTSAAEKLHLLEFVLSDQA
YGELLGLELLPLQNGSFIPFSSSVSDQDVIYISSENYPRSLFPGLEGKFILDNLKPHLLA
ALKEAAQTRGRPCTQLQLLNPERFARLIKEVVNTFWPGRELIVQWYPCDEDKKHPSISWL
KMVWKNLYIHFSEDLTLFDEMPLIPRTALEEGQTCVELIRLRIPSLVILDDESEAQLPEF
LADVVQKLGGIVLKQLDASIQHPLIKKYIHSPSPSAVLQMMEKMPLQKLCNQVASLLPTH
KDALRKFLANLTDSSEKEKRVIQELTIFKRINYSSSQGISSYTKLKGCRVLHHTSRLPAG
LRLSISVVDSSDEATIRLANLLKVEKVKTTSCLKLILKDIENAFYSHEEMTHLMLWVLEN
LSSLKNENPNVLDWLMPLKFIQISQERLVSASELFDPDVEVLKDLFYDEEETCFPPSAFT
SPDILHSLRQIGLKNEASLKEKDVVQVAKKIEALQASSCPNQEMLLKKARTLLLVLNKNH
ALLQSPEGKMALKKIKWAPACKQRPPNYPGSLVWKGDLWDLCAPADMCDAAHAILVGSSL
PLVESVHVNLEEALGIFTKPGINAVLKHFKIVVDWYTSNTFSDEDYYQFQHILLEIYGFM
HDHLNEGKDAFRALKFPWVWTGKKFCPLAQAVIKPFYDLDLQPYLHSVPKTMAKFHQLFK
ACGSVEELTPDHISMVIQKVYLKSGQDLSDQESKQNLHLMLNIIRWLYSNQIPASLNTPV
PIHHSRDPSKLIMKPIHECCYCDIKVDDLNDLLEDSVEPIILVHEDIPMKTAEWLKVPCL
STRLINPENMGFEQSGQREPLTVRIKNILEEYPSVSDIFKELLQNADDANATECSFMIDM
RRNMDIRENLLDPGMAACHGPALWSFNNSQFSDSDFVNITRLGESLKRAEVDKVGKFGLG
FNSVYHITDIPIIMSREFMIMFDPNINHISKHIKDRSNPGIKINWSKQQKRLRKFPNQFK
PFMDVFGCQLPLTVEAPYSYSGTLFRLSFRTQQEAKVSEVSSTCYNTADIYSLVDEFSLC
GHRLIIFTQSVTSMYLKYLKIEETNPSLAQDTIIIKKKLCSSKALIAPVISVLKEAAKLM
KTCDSSNKKLPADAPKSACILQITVEEFHHVFRRIADLQSPLFRGPDDDPAALFEMAKSG
QSKKPSDELPQKTMECTVWLICTCMDTGEALKFSLSESGRRLGVVPCGAVGVFLAEIQDG
KWAVRPQAGEVFCYLPLRIKTGLPVHINGCFAVTSNRKEIWKTDTKGRWNTTFMRHVVVK
AYLEALSILRDLAMSGELMDYTYHAVWPDPDLVHDDFSVICQGFYEDIAHGKGKELTRVF
SDGSTWVSMKNVRFLDDCILKRRDVGPAAFKIFLKYLKKTGSKNLCAVELPSSVKLGFEE
AGCKQILLENTFSEKQFFSEVFFPNIQEIEAELRDPLMNFVLNEKVDEFSGILRVTPCIP
CSLEGHPLVLPSRLIHPEGRVAKLFDTKDGRFPYGSTQDYLNPIILIKLVQLGMAKDDIL
WDDMLERAESVAEINKSDHGAACLRSSILLSLIDEKLKIRDPRAKDFAAKYQTIPFLPFL
TKPAGFSLDWKGNSFKPETMFAATDLYTAEHQDIVCLLQPVLNENSHSFRGCGSVPLAVK
EFLGLLRKPTVDLVINQLREVAKSVDDGITLYQENITNACYKYLHEAMMQSDITKISIIE
KLKTFSFILVESAYVDSEKIAFHLNFEAAPYLYQLPNKYKNSFRELFESVGVRQSFTVED
FALVLESIAQEKETKQITEENFQLCRRIISEGIWSLIREKKQEFCEKNYGQILLPDTNLK
LLPAKSLCYNDCPWIKVKDSTVKYCHADIPREVAVKLGAVPKRHKALERYASNICFTTLG
TEFGQKEKLTSRIKSILNAYPSEKEMLKELLQNADDAKATEICFVFDPRQHPVDRIFDDK
WAPLQGPALCVYNNQPFTEDDVRGIQNLGKGTKEGNPCKTGQYGIGFNSVYHITDCPSFI
SGNDILCIFDPHARYAPGATSVSPGRMFRDLDADFRTQFSDVLDLYLGTHFKLDNCTMFR
FPLRNAEMAKVSEISSVPSSDRMVQNLLDKLRSDGAELLMYLNHMEKISICEIDKATXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVTKKKPLKDIPVQQIYTMDTEDSEGNLTTWLI
CNRSGFSSMEKVSKSVISAHKNQDITLFPRGGVAACITHNYKKPHRFCFLPLSLETGLPF
HVNGHFALDSARRNLWRDDNGVGVRSDWNNSLMTALIAPAYVELLIQLKKRYFPGSDPTL
SVLQNTPIHVVKDTLKKFLSFFPVNRLDLQPDLYCLVKALYSCIYEDMKRLLPVVRAPNI
DGSDLHSAVIITWINMSTSNKTRPFFDNLLQDELHHLKNADYNITTRKTVAENVYRLKHL
LLEIGFNLVYNCDETANLYHCLIDADIPVSYVTPADVRSFLMTFSSPDTNCHIGKLPCRL
QQTNLKLFHSLKLLVDYCFKDAEENGIEVEGLPLLITLDSVLQTFDAKRPKFLTTYHELI
PSRKDLFMNTLYLKYSNILLNCKVAKVFDISSFADLLSSVLPREYKTKSCTKWKDSFTSE
SWLKSAWHFISESVNVKEDQEETKATFDTVVDTLKDWALLPGTKFTVSANQLVVPEGDVL
LPLSLMHIAVFPNGQSDKVFHALMKAGCIQLALNKICSKDSAFVPLLSCYTANIESPTSI
LKAVHYMVQTSTFRTEKLVESDFEALLMYFNCNLNHLMSQDDVKILKSLPCYKSISGRYM
SIAKFGTCYVLTKSIPSAEVEKWTQSSSSAFLEEKIHLKELYEVLGCVPVDDLEVYLKHL
LPKIENLSYDAKLEHLIYLKNRLSSIEELSEIKEQLFEKLESLLIIHDTNSRLKQAKHFY
DRTVRVFEVMLPEKLFIPKDFFKKLEQLIKPKNQVAFMTSWVEFLRNIGLKHILSQQQLL
QFAKEISVRANTENWSKETLQNTVDILLHHIFQERMDLLSGNFLKELSLIPFLCPERAPA
EFIRFHPQYQEVNGTLPLIKFNGAQVNPKFKQCDVLQLLWTSCPILPEKATPLSITEQEG
SDLGPQEQLEVLSMLNVNLDLPLDVINNCRNICNITTLDEDMVKTRAKVLSIYEFLSAEK
EFRFQLGVFVMVEDGWKLLGEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLGTEDIIS
TKQYVEVLSRIFKNSEGKQLDPNEMRTVKRVVSGLFKSLQNDSVKVRGDLENIRDLALYL
PSQDGRLVKSNILVFDDAPHYKSRIQGNIGVQMLVDLSQCYLGKDHGFHTKLTMLFPQKL
RPRLLSSILEEQLDEETPRVCQFGALCSLQGRLQLLLSSEQFITGLIRIMKHENDNAFLA
NEEKAVRLCKALREGLKVSCFEKLQTTLRVKGFNPIPQSRSETFAFLKRFGNAVILLYIQ
HSDSKDINFLLALAMTLKSATDNLISDTSYLIAMLGCNDIYRISEKLDSLGVKYDSSEPS
KLELPMPGTPIPAEIHYTLLMDPMNVFYPGEYVGYLVDAEGGEIYGSYQPTYTYAIIVQE
VEREDADNSSFLGKIYQIDIGYSEYKIVSSLDLYKFSRPEESSQSRDSAPSTPTSPTEFL
APGLRSIPPLFFGRESHKTSSSKHHSPKKLMVNSLPEILKEVTSVVEQAWKLPESERKKI
IRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFLDQNADRASRRTFSTSASRFQ
SEKYSFQRFYTSWNQEATSHKSERQQQNKEKCPPSAGQTYSPRFFVPPTFKSVGNPVEAR
RWLRQARANFSAARNDLHKNANEWVCFKCFLSTKLALIAADYAVRGKSDKDVKPTALAQK
IEEYSEHLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACII
IKLENFIQQKV
Download sequence
Identical sequences ENSTTRP00000011033 ENSTTRP00000011033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]