SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011114 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011114
Domain Number 1 Region: 276-343
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000723
Family UBX domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011114   Gene: ENSTTRG00000011719   Transcript: ENSTTRT00000011717
Sequence length 407
Comment pep:novel genescaffold:turTru1:GeneScaffold_55:51453:74373:1 gene:ENSTTRG00000011719 transcript:ENSTTRT00000011717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDSEVGQGDCQDLIYNSESANTLEVLGPTWTPVSFASFAAPPGFPGALSAKSGCVLMAV
SLWIICCWQNVYFAHFTNEETEPSEARCLPRPHHIPRAYVCLSFFTSELLSLLKTYNCYH
XXXXXXXXXXXEEGALIIEGLLNISWGLRRPIRLQIQDDRERVHLSPASWAPGHPECQAG
KEPPLQDGRVTAQEPGAQAGPREESSRDSSEPVEEDEETPQLMRTKSDAACVIQRRPRCR
APGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSMTNVRVNSTMTTLQVLTLLLNKFRVEN
GPSEFALYIVHESGERTKLKDSEYPLISRILHGPCEKIARIFLMEADLGEEVPHEVAQYI
KFEMPVLDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK
Download sequence
Identical sequences ENSTTRP00000011114 ENSTTRP00000011114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]