SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011199 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011199
Domain Number 1 Region: 7-70
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000353
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011199
Domain Number - Region: 146-218
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00247
Family Ubiquitin-related 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011199   Gene: ENSTTRG00000011807   Transcript: ENSTTRT00000011809
Sequence length 242
Comment pep:novel genescaffold:turTru1:GeneScaffold_3149:23299:51244:1 gene:ENSTTRG00000011807 transcript:ENSTTRT00000011809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIH
QSHPLQYIGHDRTMQXXXXXXXXXXXXXEMRKQREFYHKLGLEVPGDVKGETCSAKQHLD
SHRNGETKADDSSNKEAAEEKQEEDGDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQA
TVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMD
LL
Download sequence
Identical sequences ENSTTRP00000011199 ENSTTRP00000011199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]