SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011271 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011271
Domain Number 1 Region: 12-293
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-52
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011271
Domain Number - Region: 315-375
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0828
Family Ubiquitin-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011271   Gene: ENSTTRG00000011882   Transcript: ENSTTRT00000011882
Sequence length 744
Comment pep:novel genescaffold:turTru1:GeneScaffold_3361:482773:516738:-1 gene:ENSTTRG00000011882 transcript:ENSTTRT00000011882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPPGLRPGAGGPWEMRERLGTGGFGNVSLYQHRXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTXXXXXXXXXXX
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPIDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTCSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGVTPQASAWLPTTSAEREHPLSCVVTPQDGETLAQIIEENLNCLGHLS
TIMHEVNEKQGNSMMNLDWSWLTE
Download sequence
Identical sequences ENSTTRP00000011271 ENSTTRP00000011271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]