SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011395 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000011395
Domain Number - Region: 72-111
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00131
Family beta-sandwich domain of Sec23/24 0.016
Further Details:      
 
Domain Number - Region: 227-292
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.017
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011395   Gene: ENSTTRG00000012019   Transcript: ENSTTRT00000012016
Sequence length 451
Comment pep:novel genescaffold:turTru1:GeneScaffold_3471:18127:489608:-1 gene:ENSTTRG00000012019 transcript:ENSTTRT00000012016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA
EAKLTRTRDKEQQQQQQRQQRQRQQQQQRQRQQEPSWPALLASMGESSPAAQAHRLLAAS
SSPTLPPSPGDGGGGKGSRGRNNRGKALILGNSAKPVWRLETCYPQGASSGQCFTVESAD
AVCARNWSRGLAATGEEQQVRGTHPTPLWNLSDFYLSFCNSYTLWELFSGLSSPNTLNCS
LDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSCPEDCKIV
YKAWLCSQYFEVAQLNCRKTIPCKQYCLEVQTRCPFILPDNDEVIYGGLSSFICTGLYET
FLTNDEPECCDVRREAKSNTPSKGTVDRGGSCPRTSLPASAAPRLGPGRLRLCVLMLMLL
HTVLTASAAQNATALGVGGVHALDERSASKE
Download sequence
Identical sequences XP_019776459.1.83887 ENSTTRP00000011395 ENSTTRP00000011395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]