SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011444 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011444
Domain Number 1 Region: 496-741
Classification Level Classification E-value
Superfamily vWA-like 2.45e-71
Family Trunk domain of Sec23/24 0.0000777
Further Details:      
 
Domain Number 2 Region: 248-405,744-839
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 6.8e-71
Family beta-sandwich domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 3 Region: 946-1087
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.14e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.00068
Further Details:      
 
Domain Number 4 Region: 841-945
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.05e-30
Family Helical domain of Sec23/24 0.0076
Further Details:      
 
Domain Number 5 Region: 408-492
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.05e-22
Family Zn-finger domain of Sec23/24 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011444   Gene: ENSTTRG00000012064   Transcript: ENSTTRT00000012068
Sequence length 1091
Comment pep:novel genescaffold:turTru1:GeneScaffold_2911:38907:60843:1 gene:ENSTTRG00000012064 transcript:ENSTTRT00000012068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQSAPPVPPFGQPQPVYLGHHQSSYGGQPGPTTAPTSYGAYNGPVPGYQQTPPPGVS
RAPPSSGAPPASTAQGPCGQTAYGQFGQGDVQNGPSSTVQMQRLPGYQPFGSAILAPVVS
QPAVLQPYGPPPTSAQVTAQLAGMQISGTVAPASPPSGLGYGPPTSLASASGSFPNSGLY
GSYPQQAPPLGQAQGHPGTQPPQRSVPLQASSFTPPASGPRMSMTLPLPGQSFGPPVSQP
NHVSSPAPQALPPGTQMTGPPGPPLPPMHSSQQPGYQLQQNGSFGPTRGPQSNYGSPYPG
AATFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGSEPFVTGVRGQVPPLVTTNFL
VKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGESGP
LRCNRCKAYMCPFMQFVEGGRRFQCCFCSCINDVPPYFQHLDHTGKRVDAYDRPELSLGS
YEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRSGLVRLLCEELKSLLDFLPREGGAEES
AIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVGDMFVPLLDGFLVNVNESQAVITSLLD
QIPEMFADTRETETVFAPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDDRKL
INTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKY
ACFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMNNTTDVELAGL
DGDKTVTVEFKHDDRLNEENGALMQCALLYTSCAGQRRLRIHNLALNCCTQLADLYRNCE
TDTLINYMAKFAYRGVLSSPVKTVRDTLITQCAQILACYRKNCASPSSAGQLILPECMKL
LPVYLNCVLKSDVLQPGAEVTTDDRAYVRQLVTSMDVAETNVFFYPRLLPLTKSPIENTT
EPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFGVSSFSQITSGLSVLPV
LDNLLSKKVQGLIDSLRAQRSRYMKLIVVKQEDKLETLFKHFLVEDKSLSGGASYVDFLC
HMHKEIRQLLS
Download sequence
Identical sequences ENSTTRP00000011444 ENSTTRP00000011444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]