SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011479 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011479
Domain Number 1 Region: 51-290
Classification Level Classification E-value
Superfamily L domain-like 1.87e-25
Family Internalin LRR domain 0.018
Further Details:      
 
Domain Number 2 Region: 337-419
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000192
Family Ubiquitin-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011479   Gene: ENSTTRG00000012104   Transcript: ENSTTRT00000012104
Sequence length 422
Comment pep:novel genescaffold:turTru1:GeneScaffold_1903:434141:474529:1 gene:ENSTTRG00000012104 transcript:ENSTTRT00000012104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERT
CAGSFSGVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDYETVSCPSICCPSLKLLH
ITDNNLQDWTEIRKLGVMFPSLDTLVLANNHVNAIEEPDDSLARLFPNLRSISLHKAGLR
SWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDS
ERFFIRYYVDVPHEEEPFRYHELVTKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMTIR
LDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKILIK
TK
Download sequence
Identical sequences ENSTTRP00000011479 ENSTTRP00000011479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]