SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011646 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011646
Domain Number 1 Region: 37-330,513-574
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.15e-89
Family FAD-linked reductases, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 332-514
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.96e-57
Family GMC oxidoreductases 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011646   Gene: ENSTTRG00000012277   Transcript: ENSTTRT00000012277
Sequence length 593
Comment pep:novel genescaffold:turTru1:GeneScaffold_2121:405313:427105:-1 gene:ENSTTRG00000012277 transcript:ENSTTRT00000012277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCILRGWMRGAWAWGALGQHWPRGIRALASERPRIGGEYSHVVVGAGSAGCVLAGRLTE
DPDKRVLLLEAGPKDVFAGSKRLLWKIHMPAALVANLCDDRYNWCYHTEPQPGLDGRVLY
WPRGRVWGGSSSLNAMVYIRGHAEDYERWQREGAAGWDYAHCLPYFRKAQAHELGAGRYR
GGGGPLRVSRGKSGHPLHRAFLEAAQEAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSTA
CAYLHPALSRPTLTAETQTFVSRVLFEGTRAVGVEYIKNGQSHRAFASKEVILSGGAVNS
PQLLMLSGVGNADDLKQLGIPVVCHLPGVGQNLQDHLEIYIQQACTAPITLHSAQKPLRK
VRIGLEWLWKFTGDGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPPQQEAYQ
VHVGTMRGTSVGWLKLRSANPHDHPVIQPNYLSTETDIDDFRRCVRLTREIFAQKALAPF
RGKELQPGSHVQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPMAVVDPQTRVLGVENLR
VVDASIMPSVVSGNLNAPTIMIAEKAADIIKGRPALWDEAVPVYKPRTLATQR
Download sequence
Identical sequences ENSTTRP00000011646 ENSTTRP00000011646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]