SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011653 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011653
Domain Number 1 Region: 132-207
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000395
Family Ubiquitin-related 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011653   Gene: ENSTTRG00000012284   Transcript: ENSTTRT00000012284
Sequence length 794
Comment pep:novel genescaffold:turTru1:GeneScaffold_2390:73898:134177:-1 gene:ENSTTRG00000012284 transcript:ENSTTRT00000012284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQEEGSDAQNVDSSKEREDAFGTTNIPVPSEEVPESDQTEDCESELEPSSGGREKRVE
EPSDQSVLNLELNDVKQLMEDVTADEQVSYSPGDGGESLAKSDNAVQQLNNDSLAFLEKI
KAVEESLKTSMKDSSVTVKIVLLPVGQEIIMPFKVDTVLKRLKDHFSSLLDVPSYVLQIR
CAGMLIKDHETLLQHGVKPQDIVQVEIFSLHPFLYPIKRLDRSSDASQIITVRVQTXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIVIQTYYRRWHAK
AVVDNLKRQKMLRLQWEAQEELRKIREKEEWMKLDYYRRHNPQTKEDFELLYNALELWRQ
EELARINQSFTGARKAALCELAKETQIIASXXXXXXXXXXXXXXXXXXXXXXXCSAPKLW
RRFDGKIIEMDTQFTIRARELQNIYNCIVLKNLSQDERLDVLLTLKHTVKEHDCKLTQEI
LELIDREVDLMMRGVKHENLEGLRKRIATLFFQYIKTPLFNPEVARHLKVPQDPLKFYKK
IYFCLSCQLYLPSTEFAVSSTSHHIYRCRHCINLENETQKRESCLKYKCLLQRLYYSEAD
YEDDSKIAFLMQLQDIQYLTENIWASQSVLSTWNDLNDLVMVRWDKSLEWSPWNCILLTK
DEGTAHLKLKSIEEGYEPLFIHKIKHKHFLAKNYFSQIPVLASFLLGDGEVDEIRKKHQS
EPTSKIIDIHRPSP
Download sequence
Identical sequences ENSTTRP00000011653 ENSTTRP00000011653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]