SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011673 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011673
Domain Number 1 Region: 49-140
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-39
Family SCAN domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 223-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000157
Family KRAB domain (Kruppel-associated box) 0.0084
Further Details:      
 
Domain Number 6 Region: 353-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000441
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011673   Gene: ENSTTRG00000012308   Transcript: ENSTTRT00000012306
Sequence length 561
Comment pep:novel genescaffold:turTru1:GeneScaffold_685:40496:47007:1 gene:ENSTTRG00000012308 transcript:ENSTTRT00000012306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTAESREATGLSPHAAQEKDGIVIVKVEEEDEEEHVWGQDASLQESPPPDPEIFRQRFR
HFCYQNTFGPREALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYR
PDSGEEAVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDPVQESSSFDLPHEATQSHF
KHSSRKPRLLQPRALPATHVPAPQHEGGPRDQAMASALFSADSQAMVKIEDMAVSLILEE
WGCQNLARRNLNRDTRQENYGNVISQGCEKNEESTSKAEIAEDSASHGETTGKFQKDFGE
KRDQQGRVVERQQRNPEEKTGKEKRDPGPATVKEKKNPSTGERGPREKGKGLGRSFSLSS
NFNTPEEVPTGAKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNLVL
HQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRI
HTGEKPYECSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHTRE
RASEYSPASLDAFGAFLKSCV
Download sequence
Identical sequences XP_019786176.1.83887 XP_019786177.1.83887 ENSTTRP00000011673 ENSTTRP00000011673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]