SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011684 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011684
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-35
Family SCAN domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 402-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000126
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 222-250
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000732
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011684   Gene: ENSTTRG00000012317   Transcript: ENSTTRT00000012317
Sequence length 542
Comment pep:novel genescaffold:turTru1:GeneScaffold_2696:750710:764730:-1 gene:ENSTTRG00000012317 transcript:ENSTTRT00000012317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVELGQAPVLPPPLAKPKESVFSGPDDTPRGEPSSSEIARQLFRQFPYQVMSGPHETLR
QLRKLCSQWLQPEVHTKEQILEILTLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLR
GDPQKLWQWISIQVLGQEVLSQKAEPESCPLGEAEAHVEVPQELGLQNSACRSGEPLSHI
VKEESDSEQGLALAASPLPARPEERLIRDQDFGASLLHTAPQEQWRHLDSTQKEQYWDLM
LETYGKMVSGAGISNPKHDLTDPAGFGAELTGPHLHISEKIPRSTCIGDRQENDKENLNL
ENYRDQDPQASGEPPQTFLSGLFSKDEPRCFGEGENLPEAQENLHGEGTGAQPSPRERNS
GTQLGQHLPPLPGEPSMPWLEGKREASPRRQPRAPMAQRLPTCRECGKAFYRNSQLDFHQ
RTHTGETYFQCPTCKKAFLRSSNFVKHQRIHTGEKPCKCDTCGKGFSDFSGLRHHEKIHT
GEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSRCGKSFSWSSSLAKHQRSHLGKKP
FQ
Download sequence
Identical sequences ENSTTRP00000011684 ENSTTRP00000011684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]