SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011766 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011766
Domain Number 1 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-24
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 197-257
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-23
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 4 Region: 544-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 504-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000389
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000248
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Domain Number 9 Region: 304-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000295
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011766   Gene: ENSTTRG00000012400   Transcript: ENSTTRT00000012403
Sequence length 664
Comment pep:novel genescaffold:turTru1:GeneScaffold_2212:18583:35576:1 gene:ENSTTRG00000012400 transcript:ENSTTRT00000012403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESVTLEDVAVGLIQEWALLDDARRNLCRYALLDNCRTLAPQGTPSCKTCLVSQVGPREEL
MTAERGILCAMGVDWESQLKPKESTPLQDILEENSSHDLQMGLGLDLRMQIKPMMGERGT
PLTPGDRSALQESPWSSEDTGLKVAVQIQRVATPEPALRLLNLLGAGDSAVPAQDPTWLR
EESTEEEAVAPGTLNTCLQEPVTFADVAVLFTPEEWLFLDSAQRSLYRDVMLENYRNLTS
VGDQLCKASTFSHLEQREELCVTERGIFPGTHLEPQLQPQDSIPNQDIFAEISSIGTKRE
RPQTGEKLYKCNVLGKPINSIKPLFQYQRIPAGGNPCECRESGKPFFQTAHLIVSEKIHS
GDKTYACNKCEKSFRYSSDLIRHEKTHTAEKCFECQECRQAFKYSSNLRRHMRTHTGEKP
FECSQCGKTFTRNFNLILHQRNHTGEKPYECKDCGKAFNQPSSLRSHVRTHTGEKPFECG
QCGKAFREHSSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKLYECATCGQ
VLSRLSTLKSHMRTHTGEKPYACQECGRAFSEPSSLRKHLRTHTGKKPYACQECGRAFGQ
SSHLIVHVRTHTAGRPYECNQCEKAFRHSSSLTVHKRTHARRENVRTGGLPLSVSLAYGG
PHAD
Download sequence
Identical sequences ENSTTRP00000011766 ENSTTRP00000011766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]