SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011878 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011878
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily PX domain 2.75e-21
Family PX domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011878
Domain Number - Region: 111-205
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00258
Family Ubiquitin-related 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011878   Gene: ENSTTRG00000012519   Transcript: ENSTTRT00000012519
Sequence length 455
Comment pep:novel genescaffold:turTru1:GeneScaffold_1519:143584:148813:1 gene:ENSTTRG00000012519 transcript:ENSTTRT00000012519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFSIPETESRSGDSGGSYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFPP
KKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLEV
LLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQE
FELPYVSVASLRSQEYKIMLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVTK
EQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQL
RLPGQQLREGSFRVTRMRCWRVTSSVPLPSGGTSSPGRGRGEVRLELAFEYLMSKDRLQW
VTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLES
PDASRESMVKLSSKLSAVSLRGIGTPSTDASASDV
Download sequence
Identical sequences ENSTTRP00000011878 ENSTTRP00000011878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]