SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012048 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012048
Domain Number 1 Region: 90-193
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-27
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 195-337
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000338
Family Third domain of FERM 0.0098
Further Details:      
 
Domain Number 3 Region: 2-52
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000909
Family First domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012048   Gene: ENSTTRG00000012685   Transcript: ENSTTRT00000012699
Sequence length 589
Comment pep:novel genescaffold:turTru1:GeneScaffold_1579:240377:267258:1 gene:ENSTTRG00000012685 transcript:ENSTTRT00000012699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKILCHQLLVQVCDLLRLKDCHLFGLSVIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQ
YEVTWXXXXXXXXXXXXXXXXXXXXXXXXXXDRAARYYYYWHLRKQVLHSQCVLREEAYF
LLAAFALQADLGNFKRNKHYGKYFEPEAYFPSWVVSKRGKDYILKHIPNMHKDQFALTAS
EAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLTLGLTMRGIQIFQNLDEEKQLLYDFP
WTNVGKLVFVXXXXXXXXXXXXXXXXXXXXXXCPMRSRHLLQLLSNSHRLYMNLQPVLRH
IRKLEENEEKKQYRESYISDNLDLDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSH
TSGIEADTKVRDAGPEDAYPGSAIHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDD
EIEMLVDDPRDLERMNEESLEVSPDMCIYITEDMLLSRKLNGHSGLIVKEIGSSTSSSSE
TVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGC
GHELDEEGLYCSSCLAQQCVNIQDAFPVKRTSKYFSLDLTHDEVPEFVV
Download sequence
Identical sequences ENSTTRP00000012048 ENSTTRP00000012048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]