SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012051 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012051
Domain Number 1 Region: 133-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.72e-38
Family UAS domain 0.000000366
Further Details:      
 
Domain Number 2 Region: 376-487
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.34e-25
Family UBX domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 13-54
Classification Level Classification E-value
Superfamily UBA-like 0.000000281
Family TAP-C domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012051   Gene: ENSTTRG00000012704   Transcript: ENSTTRT00000012703
Sequence length 488
Comment pep:novel genescaffold:turTru1:GeneScaffold_253:259399:323638:-1 gene:ENSTTRG00000012704 transcript:ENSTTRT00000012703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHGGSAASSALKGLIQQFTAITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPS
TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIR
QEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFAC
QCLNRDVWSNEAVKNIIREHFIFWQXXXXXXXXXXYIQFYKLGDFPYVSILDPRTGQKLV
EWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE
THFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEIENLAKSRKSPHKDLGHRKE
ENRRSLTEPPARTEPGTATNHQGLPAMDSEILEMSPEKSDGIVEGIDVNGPKAQLMLRYP
DGKREQITLPEQAKLLALKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQE
TVFVQERN
Download sequence
Identical sequences ENSTTRP00000012051 ENSTTRP00000012051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]