SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012173 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012173
Domain Number 1 Region: 215-455
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-48
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 62-166
Classification Level Classification E-value
Superfamily POZ domain 1.75e-25
Family Tetramerization domain of potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012173   Gene: ENSTTRG00000012831   Transcript: ENSTTRT00000012831
Sequence length 505
Comment pep:novel genescaffold:turTru1:GeneScaffold_1622:16402:26680:-1 gene:ENSTTRG00000012831 transcript:ENSTTRT00000012831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPMPSRDRGLHPRHHHLGPCGPLSQFLPRPVEPPSIKGIYYRRARKLGAQDASWTADLKK
EMLVNVGGKRYLLPWSTLDEFPLSRLSKLRFCRSHEEIAQLCDDYDEDNQEFFFDRSPSA
FGVIASFLAAGKLVLLQEMCVLSFQEELTYWGIEEANLETCCLQTLLRKLDEVAELRTEE
TLQRRAAGRPTVHTSRWALFMNRLQEMVENPQSGLPGKIFACLSILFVATMAVSLCVSTM
PDLRAEEDKGECSQKCYYIFIVETVCVAWFSLEFCLRFVQAQNKCQFFQGPLNIIDILAI
SPYYVSLAVSDEPQGDGERPSRSSYVEKVGLALRVLRALRILYVMRLARHSLGLQTLGLT
VRRCTREFALLLLFLCVAITLFSPLVYVAENESGRVLEFTSIPASYWWAVISMTTVGYGD
MVPSSVPGQMVALSGILSGILIMAFPATSIFHIFSLSYLELKKQQEQLEARFRRLRSAAP
ASERELLNDVKDLILEGPALPMAYI
Download sequence
Identical sequences ENSTTRP00000012173 ENSTTRP00000012173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]