SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012210 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012210
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.98e-24
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 155-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000311
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012210   Gene: ENSTTRG00000012880   Transcript: ENSTTRT00000012873
Sequence length 527
Comment pep:novel genescaffold:turTru1:GeneScaffold_2922:6307:27714:1 gene:ENSTTRG00000012880 transcript:ENSTTRT00000012873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRCLPTVVQESVTFKDVAVLFTQDEWAQLSPAQRALYRDVMLENYSNLVSLGLLGPKP
DMFSQLGKGEEWMPEDSLGGFCLDWMTTPVSKKSTLKADIPEGELGQWMIKERFTKDTHW
KYDTLLEWQHGSQEIKLQQVMLAHEKTSSVVGNQKCDESGKHCTMSSSFVQSQGFQSSKK
AFECSECGKVFTKSSTLNKHQKIHTEKLNANRKILIKEKRYECRECGKAFHQSTHLIHHQ
RIHTGEKPYECKECGKAFSVSSSLTYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHT
GEKPFKCNICDKAFVCRAHLTKHQNIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKP
FECNECGKAFRVNSSLTEHQRIHTGEKPYKCNECGKAFRDNSSFARHRKIHTGEKPYRCG
LCEKAFRDQSALAQHQRIHTGEKPYACNICEKAFSDHSALTQHKRIHTREKPYKCKICEK
AFIRSTHLTQHQRIHTGEKPYKCNKCGKAFNQTANLIQHQRHHIGEK
Download sequence
Identical sequences ENSTTRP00000012210 ENSTTRP00000012210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]