SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012263 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012263
Domain Number 1 Region: 254-369
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.4e-34
Family UBX domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 175-269
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 5.62e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000219
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000833
Family TAP-C domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012263   Gene: ENSTTRG00000012928   Transcript: ENSTTRT00000012927
Sequence length 371
Comment pep:novel scaffold:turTru1:scaffold_84935:2837:22877:-1 gene:ENSTTRG00000012928 transcript:ENSTTRT00000012927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERQDSLREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEDEEGQRNRFYAGGSERSGQQIVGSPRKKSPNEL
VDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESYVAGERRRHSGQD
VHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHR
DEDFVKPKGAFRAFTGEGQKLGSTAPPVLNTSSPAQQAENEAKASSSISVDESQPTTNIQ
IRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADESQTLKEAN
LLNAVIVQRLT
Download sequence
Identical sequences ENSTTRP00000012263 ENSTTRP00000012263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]