SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012269 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012269
Domain Number 1 Region: 105-223
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.79e-16
Family Ubiquitin-related 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012269   Gene: ENSTTRG00000012934   Transcript: ENSTTRT00000012933
Sequence length 233
Comment pep:novel genescaffold:turTru1:GeneScaffold_258:145270:180084:-1 gene:ENSTTRG00000012934 transcript:ENSTTRT00000012933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCVGAQHDSSGSLNESEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTA
PAFEGRKEIWDALKAAAHAFENNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVY
CLAPPINMIEEKSDIETLDIPEPPPNSGYESQLRLRLSTGKDLKLVVRSTDTVYHMKRRL
HAAEGVEPASQRWFFSGRPLTDKMKLEELKIPKDYVVQVIMSQPLQNPTPVEN
Download sequence
Identical sequences ENSTTRP00000012269 ENSTTRP00000012269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]