SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012279 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012279
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 69-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 458-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000249
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012279
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000165
Family SCAN domain 0.011
Further Details:      
 
Domain Number - Region: 237-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0357
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012279   Gene: ENSTTRG00000012944   Transcript: ENSTTRT00000012944
Sequence length 521
Comment pep:novel scaffold:turTru1:scaffold_99281:60237:72927:-1 gene:ENSTTRG00000012944 transcript:ENSTTRT00000012944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASTWVKLHHPQKAKEGAPLWEDVTKMFEGEALLSQDADETQGESLKDE
VTPGTRTTDSQELLTFKDISVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGCQLSKP
SVISQLEKGEAPWMTEKEGPGNPSSDLKSKTETAASTAKNDVLQEQFYHGMMMERFMRDD
VIFSTLRKVSKYDHELESHQDSHGRDVRQTILTHKKRGQETYKFGKNIVSSNVVIEQRHH
KYDTPRKRNKYKSDLINHPTSYIRTKTYECNICEKVFKQPIHLTEHMRIHTGEKPFRCKE
CGRAFSQSASLTTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKCQKA
FSQNISLIQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTTCCKTFSHR
AYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHSSFKK
HQRHHTGEKYECNECGKAFSYNSSLTRHHEIHRRNAFQNNA
Download sequence
Identical sequences ENSTTRP00000012279 ENSTTRP00000012279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]