SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012280 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012280
Domain Number 1 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 367-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 175-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000405
Family KRAB domain (Kruppel-associated box) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012280   Gene: ENSTTRG00000012945   Transcript: ENSTTRT00000012945
Sequence length 432
Comment pep:novel scaffold:turTru1:scaffold_99281:84927:90291:-1 gene:ENSTTRG00000012945 transcript:ENSTTRT00000012945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYGNLVSVGYQLSKPGVISQLEKGEQPWLMEREISGGPSPDLEDETETKESVLKSDI
SWEELHHDLMMERSTRGSTLVSTLGRDSKCHKLENHEENQGMGAGQIPLIHKKTLTQERG
QESNRCVKSINVCSKVIPGPIDPPRKRHHKYDISRRKSRYNLGLINHSRNYTRMKTFECN
ICEKIFKQLIHLTEHMRIHTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGK
TFRHPSSLTQHVRIHTGEKPYECGVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQ
IRHLRQHEIIHTGVKPYICNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHL
SIHHRVHTGVKPYKCSHCGKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHC
KTHLRNTFSNDM
Download sequence
Identical sequences ENSTTRP00000012280 ENSTTRP00000012280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]