SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012296 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012296
Domain Number 1 Region: 47-260,388-435
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.49e-49
Family FAD-linked reductases, N-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 472-672
Classification Level Classification E-value
Superfamily Folate-binding domain 4.55e-47
Family Aminomethyltransferase folate-binding domain 0.00059
Further Details:      
 
Domain Number 3 Region: 764-849
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.03e-21
Family Aminomethyltransferase beta-barrel domain 0.00056
Further Details:      
 
Domain Number 4 Region: 260-326
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.28e-16
Family L-aminoacid/polyamine oxidase 0.0047
Further Details:      
 
Domain Number 5 Region: 726-762
Classification Level Classification E-value
Superfamily Folate-binding domain 0.000000471
Family Aminomethyltransferase folate-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012296   Gene: ENSTTRG00000012962   Transcript: ENSTTRT00000012962
Sequence length 861
Comment pep:novel genescaffold:turTru1:GeneScaffold_384:627676:687773:-1 gene:ENSTTRG00000012962 transcript:ENSTTRT00000012962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFCLGALRLRGFPLRGSPGRLLSVCGREGEENPPSPAETRWKDRAETVIIGGGCVGVSLA
YHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLEEETGQ
VVGFHQPGSIRIATTPVRVDEFKYQMTRTGWHATEQYIIEPEKIQEMFPLLNMNKILAGL
YNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKPKSDGTWDVETPQGSMRANRIV
NAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYLRQERD
GLLFGPYESQEKMKVQDSWVTNGVPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGIIHAGGVGKYLSDWILHGEPPFDLI
ELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYKTLESKCSMG
FHAGWEQPHWFYQPGQDTGYRPSFRRTNWFDPVGSEYKQVMQRVGVIDLSPFGKFNIKGQ
DSIRLLDHLFANVIPKVGFTNISHMLTPKGQVYAELTVSHQSPGEFLLITGSGSELHDLR
WIEEEAVKGGYDVEIKNITDELGVLGIAGPHARKVLQKLTSEDLSDGVFKFLQTKSLKVS
NIPVTAIRISYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXMNCDTNPLEAGLGYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATDDVDPE
GNESIWYGGKVVGNTTSGSYSYSIQKSLAFAYVPVELSKVGQQVEVELLGKNYSATVIQE
PLVLTEPIRNKLQKKGGKDKI
Download sequence
Identical sequences ENSTTRP00000012296 ENSTTRP00000012296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]