SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012406 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012406
Domain Number 1 Region: 142-229
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.28e-31
Family SCAN domain 0.0000647
Further Details:      
 
Domain Number 2 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 3 Region: 548-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-21
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 272-322
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-18
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 470-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012406
Domain Number - Region: 427-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0238
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012406   Gene: ENSTTRG00000013077   Transcript: ENSTTRT00000013076
Sequence length 616
Comment pep:novel genescaffold:turTru1:GeneScaffold_2869:100516:121599:1 gene:ENSTTRG00000013077 transcript:ENSTTRT00000013076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPVIFEDVTLGFTPDEWGMLDLEQKSLYREVLLENYRNLVSVEHQLSKPDVVSQLEEEEE
LWSVERGIPRDTFSECPEAQLDPQFHPFPAGNPLMKIEVVEILTLNEEVALPRNAQIRAL
YAEDEGLSPDILREPTQHLDKHPTDPETARQRFRGFRFEEVAGPRKLARLRELCRQWLRP
EVHSREQMLELLVLEQFLGALPGKLRMWVESQHPVDCQEAVVLVEDVTWISEEEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPVTFLDVAVDFSREEWGLLDLTQRTEY
HDVMLETFGHLVSVGWETTLSKQLTPNPNTPEEEPASLKVEEFSRDDTQPSTSGDTLQAG
APEVLDTALKPVVLTQEKTLPQKPPGESPKPQASTGPDTSHISLQKAIPRKRLRKRDPRV
KKTTHNPCVKLHQKSCSRGKDQESGSCGRTLPRGTQQITFTRIHKGSQVCRCSECGKTFR
NPRYFSVHKKIHTGEKPYVCPDCGKAFVQSSSLTQHQRVHTGERPFECHECGRTFNDRSA
ISQHLRTHTGAKPYPCQDCGKAFRQSSHLIRHQRTHTGERPYTCNKCGKAFTQSSHLIGH
QKTHSGVKCKKKQPTS
Download sequence
Identical sequences ENSTTRP00000012406 ENSTTRP00000012406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]