SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012489 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012489
Domain Number 1 Region: 178-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.01e-57
Family Voltage-gated potassium channels 0.00077
Further Details:      
 
Domain Number 2 Region: 25-139
Classification Level Classification E-value
Superfamily POZ domain 1.83e-23
Family Tetramerization domain of potassium channels 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012489   Gene: ENSTTRG00000013162   Transcript: ENSTTRT00000013161
Sequence length 494
Comment pep:novel genescaffold:turTru1:GeneScaffold_922:304459:305943:1 gene:ENSTTRG00000013162 transcript:ENSTTRT00000013161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGAGERSLPEPGSRGSRAGDDMEIVVNVGGVRRVLYGDLLSRYPETRLAELIDCLAGGY
DTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDL
KFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDTAEGRWQRCQKCVWKFLEKPESSCP
ARVVAVLSFLLILVSSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLR
LLSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQAVQALRIMRIARI
FKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHPETLFKSIPQS
FWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE
TAAKHELELMELNSSSVGEGKTGGSRGDLDNLPPEPAGKEGLSWSSQLKISRSDTFIPLL
TEEKHHRTRLQSCK
Download sequence
Identical sequences ENSTTRP00000012489 ENSTTRP00000012489 XP_004274929.1.21590 XP_004310312.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]