SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012505 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012505
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-26
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.73e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 494-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.41e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 246-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000586
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 155-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000601
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 9 Region: 104-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000124
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012505   Gene: ENSTTRG00000013177   Transcript: ENSTTRT00000013177
Sequence length 562
Comment pep:novel genescaffold:turTru1:GeneScaffold_280:52622:101309:1 gene:ENSTTRG00000013177 transcript:ENSTTRT00000013177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIISQGSLSFRDVTVGFTQEEWQHLDPAQRMLYRDVMLENYSHLISVGFCIPKPEVILKL
EQGEEPWILEEESPSQSVPELINSSRNYSRKKFDEFNKGRKWFHDEKHEGIHSEEKLYEY
NKNGNGLCLNEDSVQHQKIQILEQPFEYSECRKAFQENSLFVIHKNPYTGQNTCEYTEYR
KTFCDMSSLFAHQRTHPKENHYEFNECGENFFEESILFEHNVHPLSQKSDLIPIQRSHSI
DSIIGYNECGNFFNEKLVFGIQQSIQTGEKPYECHECGKTFNKKSAHTRHRRTHTGEKSC
ECHECGKTFCKNSDLIKHQRIHTGEKPYECQECGKSFSEKSTLTQHHRTHTGEKPYECHE
CGKSFSFKSVLTVHQKTHTGEKPYECYECGKAFLRKSDLIKHQRTHTGEKPYECNECRKS
FSEKSTLTKHLRTHTGEKPYECTECGKFFCYYSGFTEHQRRHTGEKPFGCNECGKNFRQK
SALIVHQRTHVRQKPYECNECGKSFCVKSKLTAHHRTHTGEKPYECNVCRKSFYVKSKLT
VHQRTHLGRNPINIINEGSHSG
Download sequence
Identical sequences ENSTTRP00000012505 ENSTTRP00000012505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]